PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10027290
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family bZIP
Protein Properties Length: 715aa    MW: 77177.2 Da    PI: 6.9105
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10027290genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.32.5e-11249309161
                  XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                  e++ k+  r+++NRe+A+ sRqRKk +++eLeekv ++ +   +L  +++    e a+l++
  Lus10027290 249 EEDEKKKARLMRNRESAQLSRQRKKHYVDELEEKVRAMNSIIADLNGRVSYFMAENATLRQ 309
                  678899******************************9999888888887777777777766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.3E-14249313IPR004827Basic-leucine zipper domain
PfamPF001704.9E-10250311IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.082251311IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.25E-11253311No hitNo description
Gene3DG3DSA:1.20.5.1702.3E-16253311No hitNo description
CDDcd147041.55E-20254305No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 715 aa     Download sequence    Send to blast
MADSTAAFAD ANPPPQSISF ADPLQTPPLD PLFFSSDPDN DFINDLAFHF DLHDLDPQYF  60
IPDTDDSFFL PDSTTDHADL GSALPEHDGS LQDFCFDHGN NNRVDVESEN SVISRDGCSD  120
AGKYFNSSPS QTRSFDSHET IIASAPAPAA LAIVNSAAAS PVSSHGSGDE ASGVSETMNV  180
PSPDSKSYPL SSTKLENEEA NEKSGGLPKR KKEFSDDTIE ETTRRQKCKV SETPSNSNPK  240
DATTGCGGEE DEKKKARLMR NRESAQLSRQ RKKHYVDELE EKVRAMNSII ADLNGRVSYF  300
MAENATLRQQ LVGGTPMYQH PPMHYPWMPP GAPYLVQGSK VPLVPIPRLK PQQPAASTKS  360
KKGETKKSGT RTKKVASVSF IGLLCFILMF SGLVPLINVK YGGPGENVAE GNKFSGQHFP  420
GRVLVVDGHS NISSGKTGVG FSGDTIGKMQ CQKAKNGCDN SSEQLHASLY VPRNNKLVKI  480
DGNLIIQSVL ASERTKGEAS EATGLAIANH LSSGALAIPE GTIRGKTYHS HAEQQKAIGS  540
TSADKLEEQF KSSAADGKLQ QWFHHGLAGP ILSSGVCSEV FQFDTTPSRG AIVAASSVTN  600
LTREGQQQRA NPTEKKKHRR ILHALPVPFP ASNLNVTREH RGSNNRTTYD VQRSSSSMVV  660
SVLVDPREVG DSEVDGVIVQ KSLSRVFVVV LVDGVKYVTY SCVLPRSTPH LVRA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011041392.10.0PREDICTED: uncharacterized protein LOC105137361
TrEMBLB9SJN10.0B9SJN1_RICCO; Transcription factor hy5, putative
STRINGPOPTR_0006s03300.11e-168(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF74873448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.11e-122bZIP family protein